PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v0579530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family Dof
Protein Properties Length: 87aa    MW: 10238.8 Da    PI: 10.725
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v0579530.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.84.8e-381978261
           zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                     ++++lkcprC+s ntkfCyynny+lsqPr+fCk+CrryWtkGG lrn+ vG+g+rk k+s
  Lj1g3v0579530.1 19 HHQILKCPRCESLNTKFCYYNNYNLSQPRHFCKGCRRYWTKGGLLRNITVGSGSRKPKRS 78
                     57899***************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-241977IPR003851Zinc finger, Dof-type
PfamPF027011.6E-322177IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.5872377IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102561IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MQEIHDHSMT ERKVPRPHHH QILKCPRCES LNTKFCYYNN YNLSQPRHFC KGCRRYWTKG  60
GLLRNITVGS GSRKPKRSIN KNTVPSA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572732e-44DQ857273.1 Glycine max Dof22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007138384.18e-34hypothetical protein PHAVU_009G204000g
SwissprotQ8LDR06e-34DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLA0A103XX215e-34A0A103XX21_CYNCS; Zinc finger, Dof-type
TrEMBLV7B0H79e-34V7B0H7_PHAVU; Uncharacterized protein
TrEMBLA0A068TRH11e-33A0A068TRH1_COFCA; Uncharacterized protein
STRINGVIT_17s0000g04850.t014e-33(Vitis vinifera)
STRINGPOPTR_0015s03520.15e-33(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.14e-35OBF binding protein 4